PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC6041_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 391aa    MW: 43402 Da    PI: 9.2797
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC6041_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.61.4e-38126185261
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 ++k+l+cprC+s+ntkfCyynny++sqPryfC++C+ryWt+GG++rnvPvG+grrknk +
  RrC6041_p2 126 PDKILPCPRCESANTKFCYYNNYNVSQPRYFCRNCQRYWTAGGSMRNVPVGSGRRKNKGW 185
                 7899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-30123183IPR003851Zinc finger, Dof-type
PfamPF027018.0E-32128183IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.546130184IPR003851Zinc finger, Dof-type
PROSITE patternPS013610132168IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MSKSRDTEIK LFGRTITSLV AVNHYDPSPL SAAHGGSDHR KEASSSSSSS CSPSIRPDSV  60
LADKNEKENS RFKDPYTLSQ VNEPPKAASE ILSPISSKTN TDQQSEITTT TTSTSAADKH  120
TTLKKPDKIL PCPRCESANT KFCYYNNYNV SQPRYFCRNC QRYWTAGGSM RNVPVGSGRR  180
KNKGWPSSNH YLQVTSEDYE NNNNNSGTIL SFGSLESSVT ETGKHQPGDT KIISDSASQE  240
QKPRQGFLPP QVMFANNSSP WPYNQWSPTG PNANFYPVPF YWGCTVPIWP TSETPPCLGK  300
RSRDQTEGGI KEATTITTSR LVSETLSIKE ANKTAVWSTK PERKTEGFSL FDGFETKRRN  360
GRSLVPETSI NLQANPAAMS RSMNFRENMQ Q
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00223DAPTransfer from AT1G69570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588706.10.0PREDICTED: cyclic dof factor 5-like
SwissprotQ9SEZ30.0CDF5_ARATH; Cyclic dof factor 5
TrEMBLA0A0D3CXN10.0A0A0D3CXN1_BRAOL; Uncharacterized protein
STRINGBra003994.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM130901729
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69570.10.0Dof family protein